PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.238540.1
Common NameCsa_5G641610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 203aa    MW: 23930.2 Da    PI: 8.3075
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.238540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.7e-191158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed+ll ++vk +G g+W+++a+  g++Rt+k+c++rw +yl
   Cucsa.238540.1 11 KGPWTSDEDKLLCEYVKVHGEGRWNSVAKGSGLNRTGKSCRLRWVNYL 58
                     79********************************************97 PP

2Myb_DNA-binding50.45e-1668108547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
   Cucsa.238540.1  68 TPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 108
                      9*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-22560IPR009057Homeodomain-like
PROSITE profilePS5129423.571662IPR017930Myb domain
SuperFamilySSF466897.26E-319105IPR009057Homeodomain-like
SMARTSM007176.8E-161060IPR001005SANT/Myb domain
PfamPF002491.5E-171158IPR001005SANT/Myb domain
CDDcd001671.40E-101358No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2261111IPR009057Homeodomain-like
SMARTSM007173.9E-1363111IPR001005SANT/Myb domain
PROSITE profilePS5129419.16863113IPR017930Myb domain
PfamPF002496.5E-1468108IPR001005SANT/Myb domain
CDDcd001673.75E-968109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEGKEEQEWR KGPWTSDEDK LLCEYVKVHG EGRWNSVAKG SGLNRTGKSC RLRWVNYLRP  60
GLKRCHLTPQ EEGIIIELHA LWGNKWSTIA RYLPGRTDNE IKNYWRTHFK KMKPKRKSKI  120
MVGKTDNKTM PPVTRCEEHV MELMKPYDSD NNDLSMVFTE PTAMEDHEQT YYLSMVYQDL  180
TNWAAEKKEE SLWEWPLGGF RE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25111117106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818897e-83LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132637e-83LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141594.11e-151PREDICTED: transcription factor MYB59-like
SwissprotQ4JL845e-51MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A0A0KSK21e-149A0A0A0KSK2_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000034796e-66(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.15e-62myb domain protein 121
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]